PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.013G019500.1
Common NamePOPTR_0013s02020g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family NF-YB
Protein Properties Length: 144aa    MW: 16469.3 Da    PI: 5.3344
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.013G019500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB146.46.2e-46599397
               NF-YB  3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
                        +qd++lPianv+r+mk+ lP  a++sk+ak+ +qec++efisfvtseas+kc++e+rk++ngdd++wal++lGf+dy+++   yl+kyre+e+
  Potri.013G019500.1  5 KQDQLLPIANVGRVMKQHLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKALNGDDVCWALSSLGFDDYADTTVRYLHKYREAER 97
                        79******************************************************************************************9 PP

               NF-YB 96 ek 97
                        ek
  Potri.013G019500.1 98 EK 99
                        97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.103.0E-464123IPR009072Histone-fold
SuperFamilySSF471136.89E-376120IPR009072Histone-fold
PfamPF008085.4E-23973IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006153.1E-153755No hitNo description
PRINTSPR006153.1E-155674No hitNo description
PRINTSPR006153.1E-157593No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
MDDDKQDQLL PIANVGRVMK QHLPPTARVS KEAKQRMQEC ATEFISFVTS EASNKCRKEN  60
RKALNGDDVC WALSSLGFDD YADTTVRYLH KYREAEREKA DQKKATDTEK VNKDEESNHT  120
SCQAVQQQTD QIPEPTILEF RFL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4g91_B2e-36694492Transcription factor HapC (Eurofung)
4g92_B2e-36694492Transcription factor HapC (Eurofung)
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002319000.11e-105hypothetical protein POPTR_0013s02020g
SwissprotO040275e-50NFYB4_ARATH; Nuclear transcription factor Y subunit B-4
TrEMBLB9I7Q21e-104B9I7Q2_POPTR; Uncharacterized protein
STRINGPOPTR_0013s02020.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF80532131
Representative plantOGRP16817170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09030.13e-51nuclear factor Y, subunit B4